PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 291aa    MW: 31848.7 Da    PI: 6.5117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039214genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l d++++ G g+W+t ++  g+ R++k+c++rw +yl
      Lus10039214 14 RGAWSAEEDEILSDYINKNGHGSWRTLPQNAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding49.78.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+  +v + + lG++ W++Ia+ ++ gRt++++k++w+++l
      Lus10039214  67 RGSFSPEEESTIVGLQATLGNK-WASIASQLP-GRTDNEIKNHWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.115961IPR017930Myb domain
SuperFamilySSF466895.62E-2811108IPR009057Homeodomain-like
SMARTSM007175.1E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.86E-91661No hitNo description
PROSITE profilePS5129423.7362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2465115IPR009057Homeodomain-like
SMARTSM007175.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1467112IPR001005SANT/Myb domain
CDDcd001674.36E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRSPCCDRN GVKRGAWSAE EDEILSDYIN KNGHGSWRTL PQNAGLLRCG KSCRLRWTNY  60
LRPDIKRGSF SPEEESTIVG LQATLGNKWA SIASQLPGRT DNEIKNHWNT HLKKRFPAPL  120
PKKAAPNKVE AWQASMDESS SMLLTNTPPL PPPPPSSPVS QNFAKDHYLK LWYSDVGESF  180
RNIRVECESS NSQVSSFSKL GSGSVDDTLT TMMATPTTAT TNLVDATNMM VGPNPGLDGM  240
VSSSGSINSN EFTSYSDTAL KQLLAMPGGN SVMEFLENDD VFTNFPFRCD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744470.0JX174447.1 Linum usitatissimum clone LuBAC375N24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090267.15e-92PREDICTED: transcription factor MYB3-like
SwissprotO222641e-59MYB12_ARATH; Transcription factor MYB12
TrEMBLI6Y9M10.0I6Y9M1_LINUS; Myb-like DNA-binding domain protein
STRINGPOPTR_0015s13180.14e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.14e-64myb domain protein 17